Soybean Meal — Spécifications, fournisseurs et RFQ

Soybean Meal : spécifications techniques, origines mondiales, certifications GMP+/FAMI-QS et devis vérifiés. The global reference vegetable protein for monog…

Protein Meals & Alternative Proteins

Soybean Meal

Also known as: SBM · Soya meal · Soymeal

The global reference vegetable protein for monogastric diets. 44–48% CP, excellent amino-acid balance, benchmark of least-cost formulation worldwide.

Applications by species

broilerslayersbreedersturkeyswinedairytilapiashrimpsalmon

Top global export origins

Brazil Argentina United States Paraguay India

FeedMatch Group's RFQ Builder benchmarks landed costs across origins for your discharge port and shipment window.

Certifications & quality standards

GMP+ FAMI-QS RTRS ProTerra Non-GMO (EU segregated)
GMO status drives price stratification. EU, MENA and Asia-Pacific buyers increasingly require RTRS or deforestation-free (EUDR) documentation.

Buyer considerations

Advantages

  • Best-in-class lysine and total amino-acid profile among plant proteins
  • Deep, liquid global market — daily CBOT and Rosario price discovery
  • Well-characterized by every feed formulation package

Constraints & risks

  • Anti-nutritional factors (trypsin inhibitors) require adequate toasting
  • Price and availability tied to South American harvests and USD/BRL/ARS
  • Deforestation and land-use scrutiny in some EU/UK supply chains

Frequently asked questions

What is the difference between 46% and 48% protein soybean meal?

48% CP (dehulled/hi-pro) SBM has hulls removed after extraction, raising protein and lowering fibre. 46% CP is standard and preferred where fibre is not a constraint. Price differential is typically €10–25/t.

Can I substitute soybean meal in broiler diets?

Partial substitution with canola meal (up to 15%), sunflower meal (up to 10%), or emerging alternatives like insect and single-cell protein is common. Full substitution rarely pencils out on total amino-acid cost.

How do I procure soybean meal internationally?

Use FeedMatch Group's RFQ Builder to request quotes from vetted origin exporters (Brazil, Argentina, US) with certifications, incoterms and shipment window. Typical parcel sizes: 25 t containers, 3,000 t break-bulk, up to Panamax 60,000 t.

Get a Free QuoteExplore Financing